OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NR2E3 (NM_014249) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315425
Recombinant protein of human nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806203 NR2E3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NR2E3 or NM_014249"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215425 representing NM_014249
Red=Cloning site Green=Tags(s)

METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGF
FKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTE
SRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYS
SSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAP
PEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQ
VMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 44.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055064
Locus ID 10002
UniProt ID Q9Y5X4
Cytogenetics 15q23
RefSeq Size 1999
RefSeq ORF 1230
Synonyms ESCS; PNR; rd7; RNR; RP37
Summary This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system Diseases, Transciption Factors
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NR2E3" proteins (9)
SKU Description Size Price
PH315425 NR2E3 MS Standard C13 and N15-labeled recombinant protein (NP_055064) 10 ug
$3,360.00
PH320677 NR2E3 MS Standard C13 and N15-labeled recombinant protein (NP_057430) 10 ug
$3,360.00
LC402296 Lyophilized NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414039 Lyophilized NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429495 Lyophilized NR2E3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402296 Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY414039 Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY429495 Transient overexpression lysate of nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP320677 Recombinant protein of human nuclear receptor subfamily 2, group E, member 3 (NR2E3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products