OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UGT2B15 (NM_001076) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315344
Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "UGT2B15 or NM_001076"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215344 representing NM_001076
Red=Cloning site Green=Tags(s)

MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSS
AIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMK
LQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFME
RIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG
LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS
NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH
SLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001067
Locus ID 7366
UniProt ID P54855
Cytogenetics 4q13.2
RefSeq Size 2144
RefSeq ORF 1590
Synonyms HLUG4; UDPGT 2B8; UDPGT2B15; UDPGTH3; UGT2B8
Summary This gene encodes a glycosyltransferase that is invovled in the metabolism and elimination of toxic compounts, both endogenous and of xenobiotic origin. This gene plays a role in the regulation of estrogens and androgens. This locus is present in a cluster of similar genes and pseudogenes on chromosome 4. provided by RefSeq, Aug 2016
Protein Categories Membrane Proteins
Protein Families Transmembrane
Protein Pathways Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UGT2B15" proteins (1)
SKU Description Size Price
PH315344 UGT2B15 MS Standard C13 and N15-labeled recombinant protein (NP_001067) 10 ug
$3,360.00

file-alt Citations

Human Hepatic UGT2B15 Developmental Expression
Divakaran, Hines, McCarver
Toxicol. Sci. (2014)
Cited by 46
AI Summary: OriGene’s purified recombinant UGT2B15 protein was used as a protein standard to quantify UGT2B15 levels in human liver samples, enabling accurate measurement of developmental changes in UGT2B15 expression.
Snippet: Biosciences (Woburn, MA). Purified, recombinant UGT2B15 protein was obtained from Origene Technologies (Rockville, MD). ... The amount of UGT2B15 present in the supersomes was quantified using standard curves of recombinant UGT2B15 protein standards (Origene ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products