OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF4H (NM_022170) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314822
Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA343913 Rabbit Polyclonal Anti-WBSCR1 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EIF4H or NM_022170"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214822 representing NM_022170
Red=Cloning site Green=Tags(s)

MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSV
RLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGS
SRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPR
LQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071496
Locus ID 7458
UniProt ID Q15056
Cytogenetics 7q11.23
RefSeq Size 2546
RefSeq ORF 744
Synonyms eIF-4H; WBSCR1; WSCR1
Summary This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF4H" proteins (5)
SKU Description Size Price
PH304028 EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_114381) 10 ug
$3,360.00
PH314822 EIF4H MS Standard C13 and N15-labeled recombinant protein (NP_071496) 10 ug
$3,360.00
LC410402 Lyophilized EIF4H HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410402 Transient overexpression lysate of eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304028 Recombinant protein of human eukaryotic translation initiation factor 4H (EIF4H), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products