OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBL1Y (NM_134258) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314764
Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA350573 Rabbit Polyclonal Anti-TBL1Y Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TBL1Y or NM_134258"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214764 protein sequence
Red=Cloning site Green=Tags(s)

MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDG
TVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREA
TVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNE
NSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIF
ALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH
PVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN
SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY
QGTGGIFEVCWNARGDKVGASASDGSVCVLDL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_599020
Locus ID 90665
UniProt ID Q9BQ87
Cytogenetics Yp11.2
RefSeq Size 2376
RefSeq ORF 1566
Synonyms DFNY2; TBL1
Summary The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This gene is highly similar to TBL1X gene in nucleotide sequence and protein sequence, but the TBL1X gene is located on chromosome X and this gene is on chromosome Y. This gene has three alternatively spliced transcript variants encoding the same protein. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Families Transcription Factors
Protein Pathways Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TBL1Y" proteins (11)
SKU Description Size Price
PH312240 TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599021) 10 ug
$3,360.00
PH314764 TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599020) 10 ug
$3,360.00
PH320139 TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_150600) 10 ug
$3,360.00
LC408755 Lyophilized TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408756 Lyophilized TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409606 Lyophilized TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408755 Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY408756 Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY409606 Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP312240 Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 3, 20 µg 20 ug
$867.00
TP320139 Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products