OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dystrophin (DMD) (NM_004021) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313926
Recombinant protein of human dystrophin (DMD), transcript variant Dp140b, 20 µg
Size:
20 ug 1 mg 100 ug
Formulation:
Liquid Lyophilized
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA375509 Dystrophin Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Dystrophin or NM_004021"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213926 representing NM_004021
Red=Cloning site Green=Tags(s)

MPSSLMLEVPALADFNRAWTELTDWLSLLDQVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEEL
ITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQAR
AKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVANDLALKLLRDYSADDTRKVHMITENINASW
RSIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQD
LQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRL
HLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEG
LEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKL
RQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDL
NTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTE
LYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDR
LEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCD
QRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHR
VAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVR
DFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHY
ASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERIL
ADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILE
DHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQ
DTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 143 kDa
Concentration >0.1 mg/mL
Purity >90%
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004012
Locus ID 1756
UniProt ID P11532
Cytogenetics Xp21.2-p21.1
RefSeq Size 7378
RefSeq ORF 3729
Synonyms BMD; CMD3B; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; MRX85
Summary This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene. provided by RefSeq, Dec 2016
Protein Categories ADC Targets, Cardiovascular diseases, Growth Factors, Intracellular Proteins
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Dystrophin" proteins (14)
SKU Description Size Price
PH313926 DMD MS Standard C13 and N15-labeled recombinant protein (NP_004012) 10 ug
$3,360.00
PH315529 DMD MS Standard C13 and N15-labeled recombinant protein (NP_004009) 10 ug
$3,360.00
LC418275 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418276 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418277 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418278 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418279 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418281 Lyophilized DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418275 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71 (as WB positive control) 100 ug
$665.00
LY418276 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71b (as WB positive control) 100 ug
$665.00
LY418277 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71a (as WB positive control) 100 ug
$665.00
LY418278 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71ab (as WB positive control) 100 ug
$665.00
LY418279 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp40 (as WB positive control) 100 ug
$436.00
LY418281 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp140b (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products