Dystrophin (DMD) (NM_004018) Human Mass Spec Standard

SKU
PH315529
DMD MS Standard C13 and N15-labeled recombinant protein (NP_004009)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215529]
Predicted MW 70.6 kDa
Protein Sequence
Protein Sequence
>RC215529 representing NM_004018
Red=Cloning site Green=Tags(s)

MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNL
KQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCK
AHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEA
ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAK
GHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHD
DTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE
ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGR
LEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMG
EEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004009
RefSeq Size 4552
RefSeq ORF 1866
Synonyms BMD; CMD3B; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; MRX85
Locus ID 1756
UniProt ID P11532
Cytogenetics Xp21.2-p21.1
Summary This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene. [provided by RefSeq, Dec 2016]
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis
Write Your Own Review
You're reviewing:Dystrophin (DMD) (NM_004018) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313926 DMD MS Standard C13 and N15-labeled recombinant protein (NP_004012) 10 ug
$3,255.00
LC418275 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418276 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418277 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418278 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418279 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418281 DMD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418275 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71 100 ug
$665.00
LY418276 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71b 100 ug
$665.00
LY418277 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71a 100 ug
$665.00
LY418278 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71ab 100 ug
$665.00
LY418279 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp40 100 ug
$436.00
LY418281 Transient overexpression lysate of dystrophin (DMD), transcript variant Dp140b 100 ug
$665.00
TP313926 Recombinant protein of human dystrophin (DMD), transcript variant Dp140b, 20 µg 20 ug
$867.00
TP315529 Recombinant protein of human dystrophin (DMD), transcript variant Dp71ab, 20 µg 20 ug
$867.00
TP762385 Purified recombinant protein of Human dystrophin (DMD), transcript variant Dp427m, Lys3200-Thr3684, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.