Dystrophin (DMD) (NM_004018) Human Recombinant Protein
SKU
TP315529
Recombinant protein of human dystrophin (DMD), transcript variant Dp71ab, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC215529 representing NM_004018
Red=Cloning site Green=Tags(s) MREQLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNL KQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCK AHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEA ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAK GHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPASSPQLSHD DTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESE ERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGR LEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMG EEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004009 |
Locus ID | 1756 |
UniProt ID | P11532 |
Cytogenetics | Xp21.2-p21.1 |
RefSeq Size | 4552 |
RefSeq ORF | 1866 |
Synonyms | BMD; CMD3B; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; MRX85 |
Summary | This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene. [provided by RefSeq, Dec 2016] |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313926 | DMD MS Standard C13 and N15-labeled recombinant protein (NP_004012) | 10 ug |
$3,255.00
|
|
PH315529 | DMD MS Standard C13 and N15-labeled recombinant protein (NP_004009) | 10 ug |
$3,255.00
|
|
LC418275 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC418276 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC418277 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC418278 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC418279 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC418281 | DMD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY418275 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71 | 100 ug |
$665.00
|
|
LY418276 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71b | 100 ug |
$665.00
|
|
LY418277 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71a | 100 ug |
$665.00
|
|
LY418278 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp71ab | 100 ug |
$665.00
|
|
LY418279 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp40 | 100 ug |
$436.00
|
|
LY418281 | Transient overexpression lysate of dystrophin (DMD), transcript variant Dp140b | 100 ug |
$665.00
|
|
TP313926 | Recombinant protein of human dystrophin (DMD), transcript variant Dp140b, 20 µg | 20 ug |
$867.00
|
|
TP762385 | Purified recombinant protein of Human dystrophin (DMD), transcript variant Dp427m, Lys3200-Thr3684, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.