GADD45B (NM_015675) Human Recombinant Protein
CAT#: TP313354
Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213354 representing NM_015675
Red=Cloning site Green=Tags(s) MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA LQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVA SYCEESRGNNQWVPYISLQER myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056490 |
Locus ID | 4616 |
UniProt ID | O75293 |
Cytogenetics | 19p13.3 |
Refseq Size | 1121 |
Refseq ORF | 483 |
Synonyms | GADD45BETA; MYD118 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414404 | GADD45B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414404 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, beta (GADD45B) |
USD 436.00 |
|
PH313354 | GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490) |
USD 3,255.00 |
|
TP720537 | Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B) |
USD 330.00 |
|
TP761954 | Purified recombinant protein of Human growth arrest and DNA-damage-inducible, beta (GADD45B),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review