OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Plunc (BPIFA1) (NM_016583) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313322
Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA344133 Rabbit Polyclonal Anti-PLUNC Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Plunc or NM_016583"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213322 representing NM_016583
Red=Cloning site Green=Tags(s)

MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN
LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ
VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI
LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057667
Locus ID 51297
UniProt ID Q9NP55
Cytogenetics 20q11.21
RefSeq Size 1049
RefSeq ORF 768
Synonyms bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT
Summary This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. provided by RefSeq, Aug 2014
Protein Categories Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Plunc" proteins (7)
SKU Description Size Price
PH303060 PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) 10 ug
$3,360.00
PH313322 PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_057667) 10 ug
$3,360.00
LC402569 Lyophilized BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408781 Lyophilized BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402569 Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408781 Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303060 Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

Anti-BPIFA1/SPLUNC1: A new autoantibody prevalent in patients with endstage cystic fibrosis
Budding, van de Graaf, Hoefnagel
Journal of Cystic Fibrosis (2013)
AI Summary: OriGene's purified recombinant BPIFA1 protein was used as an antigen in ELISA assays to quantify antibody levels in the study.
Snippet: Antibody levels were quantified with ELISAs using purified native BPI (Athens Research &Technology, Inc., Athens, GA), and purified recombinant BPIFA1 (OriGene Technologies, Inc., Rockville, MD), as antigens, respectively.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products