EDDM3B (NM_022360) Human Recombinant Protein

CAT#: TP313305

Recombinant protein of human family with sequence similarity 12, member B (epididymal) (FAM12B), 20 µg

Product Images

Coomassie blue staining of purified EDDM3B protein (Cat# TP313305). The protein was produced from HEK293T cells transfected with EDDM3B cDNA clone (Cat# RC213305) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213305 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSVKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY
  ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK
  MVEPIGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071755
• Locus ID: 64184
• UniProt ID: P56851, W0UV31
• Cytogenetics: 14q11.2
• Refseq Size: 897
• Refseq ORF: 441
• Synonyms: EP3B; FAM12B; HE3-BETA; HE3B; RAM2
• Summary: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane