OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDDM3B (NM_022360) Human Mass Spec Standard

Be the first to review this product
SKU
PH313305
EDDM3B MS Standard C13 and N15-labeled recombinant protein (NP_071755)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357141 EDDM3B Antibody - middle region
100 ul
$585.00
LY411686 Transient overexpression lysate of epididymal protein 3B (EDDM3B) (as WB positive control) 100 ug
$436.00

Other products for "EDDM3B or NM_022360"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213305
Predicted MW 17.6 kDa
Protein Sequence
Protein Sequence
>RC213305 protein sequence
Red=Cloning site Green=Tags(s)

MASSVKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY
ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK
MVEPIGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071755
RefSeq Size 897
RefSeq ORF 441
Synonyms EP3B; FAM12B; HE3-BETA; HE3B; RAM2
Locus ID 64184
UniProt ID P56851
Cytogenetics 14q11.2
Summary Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. provided by RefSeq, Jul 2008
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EDDM3B" proteins (3)
SKU Description Size Price
LC411686 Lyophilized EDDM3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411686 Transient overexpression lysate of epididymal protein 3B (EDDM3B) (as WB positive control) 100 ug
$436.00
TP313305 Recombinant protein of human family with sequence similarity 12, member B (epididymal) (FAM12B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products