LHPP (NM_022126) Human Recombinant Protein

CAT#: TP313279

Recombinant protein of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), 20 µg

Product Images

Coomassie blue staining of purified LHPP protein (Cat# TP313279). The protein was produced from HEK293T cells transfected with LHPP cDNA clone (Cat# RC213279) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213279 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR
  LGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ
  VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV
  MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071409
• Locus ID: 64077
• UniProt ID: Q9H008
• Cytogenetics: 10q26.13
• Refseq Size: 1703
• Refseq ORF: 810
• Synonyms: HDHD2B
• Summary: Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Oxidative phosphorylation