OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSD17B13 (NM_178135) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313132M
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 13 (HSD17B13), transcript variant A, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA592047 Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
100 ul
$519.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HSD17B13 or NM_178135"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213132 protein sequence
Red=Cloning site Green=Tags(s)

MNIILEILLLLITIIYSYLESLVKFFIPQRRKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINK
RGVEETAAECRKLGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT
FEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTG
IKTSCLCPVFVNTGFTKNPSTRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERASAI
LNRMQNIQFEAVVGHKIKMK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835236
Locus ID 345275
UniProt ID Q7Z5P4
Cytogenetics 4q22.1
RefSeq Size 2397
RefSeq ORF 900
Synonyms HMFN0376; NIIL497; SCDR9; SDR16C3
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Discovery of the First-In-Class HSD17B13/PPAR Multitarget Modulators for the Treatment of Metabolic Dysfunction-Associated Steatohepatitis
Liang, Chen, Liao et al
J Med Chem (2025) 68 (21), 22938-22958 DOI: 10.1021/acs.jmedchem.5c01825
Cited by 3
AI Summary: OriGene’s recombinant human and mouse HSD17B13 proteins (TP313132) were used to assess compound activity in enzyme inhibition assays, enabling the evaluation of multitarget modulators for treating metabolic dysfunction-associated steatohepatitis in this study.
Snippet: ds was assessed by NAD(P)H-Glo luciferase assay (Promega, G9061) using a purified recombinant human/mouse HSD17B13 protein (Origene, TP313132). … The mixture included 0.4 μL of compounds (50× FAC, 10% DMSO) and 2 μL/well of hHSD17B13 (65 nM FAC in assay buffer) or mHSD17B13 protein (120 nM FAC in assay buffer), which were added to a 384-well plate (Corning, 3872), and replicate points were designed at each concen
Discovery of Highly Potent, Selective, and Liver-Targeting HSD17B13 Inhibitor with Robust In Vivo Anti-MASH Activity
Chen, Liang, Mao et al
J Med Chem (2025)
Cited by 10
AI Summary: OriGene’s purified HSD17B13 protein (catalog number TP313132) was used in a biochemical enzyme activity assay to evaluate the inhibitory effects of test compounds in this study.
Snippet: The HSD17B13 enzyme inhibitory effect of the test compounds was measured using a purified protein (Origene TP313132) biochemical enzyme activity assay with an NAD
Discovery of a Novel Potent and Selective HSD17B13 Inhibitor, BI-3231, a Well-Characterized Chemical Probe Available for Open Science
Thamm, Willwacher, Aspnes et al
J Med Chem (2023) 66 (4), 2832-2850 DOI: 10.1021/acs.jmedchem.2c01884
Cited by 22
AI Summary: OriGene’s recombinant human HSD17B13 protein (cat# TP313132) was used in high-throughput screening and biochemical assays to identify and characterize the novel HSD17B13 inhibitor BI-3231 in this study.
Snippet: (1% DMSO final concentration in the assay). Experiments to select the high-throughput screening substrate were performed using commercially available recombinant human HSD17B13 (transcript variant A, OriGene cat# TP313132;final conc. 228 nM). Compound profiling and mode of inhibition studies were performed using purified, recombinant human HSD17B13 (final conc. 1 nM), human HSD17B11 (final conc
FigureFigureFigure
Genome-wide association study of non-alcoholic fatty liver and steatohepatitis in a histologically characterised cohort☆
Anstee, Darlay, Cockell et al
J. Hepatol. (2020) 73 (3), 505-515 DOI: 10.1016/j.jhep.2020.04.003
Cited by 530
AI Summary: OriGene’s recombinant HSD17B13 protein (catalog number TP313132) was used to assess HSD17B13 enzymatic activity in substrate assays, contributing to the functional characterization of genetic variants identified in the study.
Snippet: … Louis, Missouri, USA) was incubated with recombinant HSD17B13 (TP313132;Origene, Maryland, USA) for 1h at room temperature in the presence of 0.5 mM NAD in 200 mM Tris-HCl, pH7.5. As a control, the known HSD17B13 substrate ß-estradiol (75 µM) was incubated in parallel assays. …
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products