ALS2CL (NM_182775) Human Recombinant Protein

CAT#: TP313063

Recombinant protein of human ALS2 C-terminal like (ALS2CL), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified ALS2CL protein (Cat# TP313063). The protein was produced from HEK293T cells transfected with ALS2CL cDNA clone (Cat# RC213063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213063 representing NM_182775
  Red=Cloning site Green=Tags(s)
  
  MEDILEELLQHREPKALQLYLRKALSNSLHPLGKLLRTLMLTFQATYAGVGANKHLQELAQEEVKQHAQE
  LWAAYRGLLRVALERKGQALEEDEDTETRDLQVHGLVLPLMLPSFYSELFTLYLLLHEREDSFYSQGIAN
  LSLFPDTQLLEFLDVQKHLWPLKDLTLTSNQRYSLVRDKCFLSATECLQKIMTTVDPREKLEVLERTYGE
  IEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALESCYEHI
  QKEDMRLHRLPGHWHSRELW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_877576
• Locus ID: 259173
• UniProt ID: Q60I27
• Cytogenetics: 3p21.31
• Refseq Size: 3148
• Refseq ORF: 900
• Synonyms: RN49018
• Summary: Acts as a guanine nucleotide exchange factor (GEF) for Rab5 GTPase. Regulates the ALS2-mediated endosome dynamics.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome