OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHLAG (CD74) (NM_001025159) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312964
Recombinant protein of human CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA507339 CD74 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DHLAG or NM_001025159"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212964 representing NM_001025159
Red=Cloning site Green=Tags(s)

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF
LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED
HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL
TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP
SSGLGVTKQDLGPVPM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020330
Locus ID 972
UniProt ID P04233
Cytogenetics 5q33.1
RefSeq Size 1519
RefSeq ORF 888
Synonyms DHLAG; HLADG; Ia-GAMMA; II; p33
Summary The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Aug 2011
Protein Categories ADC Targets, CD Markers, Chemokines, Cytokines, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Antigen processing and presentation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHLAG" proteins (9)
SKU Description Size Price
PH312964 CD74 MS Standard C13 and N15-labeled recombinant protein (NP_001020330) 10 ug
$3,360.00
LC418040 Lyophilized CD74 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422594 Lyophilized CD74 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422595 Lyophilized CD74 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429196 Lyophilized CD74 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418040 Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422594 Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422595 Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY429196 Transient overexpression lysate of CD74 molecule, major histocompatibility complex, class II invariant chain (CD74), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products