TIP30 (HTATIP2) (NM_001098522) Human Recombinant Protein

SKU TP312332

Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212332 protein sequence; Red=Cloning site Green=Tags(s); ; MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV; DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN; FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM; LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001091992
• Locus ID: 10553
• UniProt ID: Q9BUP3
• Cytogenetics: 11p15.1
• RefSeq Size: 1719
• RefSeq ORF: 726
• Synonyms: CC3; SDR44U1; TIP30
• Summary: Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome