OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIP30 (HTATIP2) (NM_001098522) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312332
Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA331157 Rabbit Polyclonal Anti-HTATIP2 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TIP30 or NM_001098522"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212332 protein sequence
Red=Cloning site Green=Tags(s)

MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVV
DFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN
FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAM
LNNVVRPRDKQMELLENKAIHDLGKAHGSLKP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001091992
Locus ID 10553
UniProt ID Q9BUP3
Cytogenetics 11p15.1
RefSeq Size 1719
RefSeq ORF 726
Synonyms CC3; SDR44U1; TIP30
Summary Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIP30" proteins (11)
SKU Description Size Price
PH300276 HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_006401) 10 ug
$3,360.00
PH312332 HTATIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001091992) 10 ug
$3,360.00
LC416670 Lyophilized HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420619 Lyophilized HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420620 Lyophilized HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420621 Lyophilized HTATIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416670 Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420619 Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420620 Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY420621 Transient overexpression lysate of HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP300276 Recombinant protein of human HIV-1 Tat interactive protein 2, 30kDa (HTATIP2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products