TIP30 (HTATIP2) Rabbit Polyclonal Antibody

SKU TA331157

Rabbit Polyclonal Anti-HTATIP2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTATIP2 antibody: synthetic peptide directed towards the N terminal of human HTATIP2. Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: HIV-1 Tat interactive protein 2
• Database Link:
  NP_006401
  Q9BUP3
• Background: CC3 (HTATIP2) is a member of the short-chain dehydrogenases/reductases (SDR) family. It is a novel serine/threonine kinase that phosphorylates the C-terminal domain (CTD) of the largest RNA polymerase II subunit and induces the expression of apoptosis related genes Bad and Siva, as well as metastasis suppressor NM23-H2. It also interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription.
• Synonyms: CC3; SDR44U1; TIP30
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome