OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Decorin (DCN) (NM_133503) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP312223
Recombinant protein of human decorin (DCN), transcript variant A2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA327131 DCN Rabbit Polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Decorin or NM_133503"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212223 protein sequence
Red=Cloning site Green=Tags(s)

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL
GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ
LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT
NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK
LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR
SAIQLGNYK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_598010
Locus ID 1634
UniProt ID P07585
Cytogenetics 12q21.33
RefSeq Size 2151
RefSeq ORF 1077
Synonyms CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B
Summary This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. provided by RefSeq, Nov 2015
Protein Categories Growth Factors, Intracellular Proteins, Nervous system Diseases, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways TGF-beta signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Decorin" proteins (11)
SKU Description Size Price
PH302753 DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) 10 ug
$3,360.00
PH312223 DCN MS Standard C13 and N15-labeled recombinant protein (NP_598010) 10 ug
$3,360.00
PH318427 DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) 10 ug
$3,360.00
LC403339 Lyophilized DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419655 Lyophilized DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429085 Lyophilized DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403339 Transient overexpression lysate of decorin (DCN), transcript variant A2 (as WB positive control) 100 ug
$436.00
LY419655 Transient overexpression lysate of decorin (DCN), transcript variant A1 (as WB positive control) 100 ug
$436.00
LY429085 Transient overexpression lysate of decorin (DCN), transcript variant A1 (as WB positive control) 100 ug
$436.00
TP302753 Recombinant protein of human decorin (DCN), transcript variant A1, 20 µg 20 ug
$867.00
TP318427 Recombinant protein of human decorin (DCN), transcript variant D, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products