Decorin (DCN) (NM_133503) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212223] |
Predicted MW | 39.7 kDa |
Protein Sequence |
Protein Sequence
>RC212223 protein sequence
Red=Cloning site Green=Tags(s) MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR SAIQLGNYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_598010 |
RefSeq Size | 2151 |
RefSeq ORF | 1077 |
Synonyms | CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B |
Locus ID | 1634 |
UniProt ID | P07585 |
Cytogenetics | 12q21.33 |
Summary | This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302753 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) | 10 ug |
$3,255.00
|
|
PH318427 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) | 10 ug |
$3,255.00
|
|
LC403339 | DCN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419655 | DCN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429085 | DCN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403339 | Transient overexpression lysate of decorin (DCN), transcript variant A2 | 100 ug |
$436.00
|
|
LY419655 | Transient overexpression lysate of decorin (DCN), transcript variant A1 | 100 ug |
$436.00
|
|
LY429085 | Transient overexpression lysate of decorin (DCN), transcript variant A1 | 100 ug |
$436.00
|
|
TP302753 | Recombinant protein of human decorin (DCN), transcript variant A1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312223 | Recombinant protein of human decorin (DCN), transcript variant A2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP318427 | Recombinant protein of human decorin (DCN), transcript variant D, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.