Decorin (DCN) (NM_133503) Human Mass Spec Standard

SKU
PH312223
DCN MS Standard C13 and N15-labeled recombinant protein (NP_598010)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212223]
Predicted MW 39.7 kDa
Protein Sequence
Protein Sequence
>RC212223 protein sequence
Red=Cloning site Green=Tags(s)

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL
GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ
LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT
NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK
LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR
SAIQLGNYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_598010
RefSeq Size 2151
RefSeq ORF 1077
Synonyms CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B
Locus ID 1634
UniProt ID P07585
Cytogenetics 12q21.33
Summary This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways TGF-beta signaling pathway
Write Your Own Review
You're reviewing:Decorin (DCN) (NM_133503) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302753 DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) 10 ug
$3,255.00
PH318427 DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) 10 ug
$3,255.00
LC403339 DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419655 DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429085 DCN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403339 Transient overexpression lysate of decorin (DCN), transcript variant A2 100 ug
$436.00
LY419655 Transient overexpression lysate of decorin (DCN), transcript variant A1 100 ug
$436.00
LY429085 Transient overexpression lysate of decorin (DCN), transcript variant A1 100 ug
$436.00
TP302753 Recombinant protein of human decorin (DCN), transcript variant A1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312223 Recombinant protein of human decorin (DCN), transcript variant A2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318427 Recombinant protein of human decorin (DCN), transcript variant D, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.