OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRP5L (NM_182492) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311399
Recombinant protein of human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337415 Rabbit Polyclonal Anti-LRP5L Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LRP5L or NM_182492"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211399 representing NM_182492
Red=Cloning site Green=Tags(s)

MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI
LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA
KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK
AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_872298
Locus ID 91355
UniProt ID A4QPB2
Cytogenetics 22q11.23
RefSeq Size 3601
RefSeq ORF 756
Synonyms DKFZp434O0213
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRP5L" proteins (6)
SKU Description Size Price
PH311399 LRP5L MS Standard C13 and N15-labeled recombinant protein (NP_872298) 10 ug
$3,360.00
LC405514 Lyophilized LRP5L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427704 Lyophilized LRP5L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405514 Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427704 Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP760928 Purified recombinant protein of Human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products