OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCEAL2 (NM_080390) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311139
Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA339784 Rabbit Polyclonal Anti-TCEAL2 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TCEAL2 or NM_080390"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211139 protein sequence
Red=Cloning site Green=Tags(s)

MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKA
KGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKR
KTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREF
RGGCRAPRRDTEDIPYV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_525129
Locus ID 140597
UniProt ID Q9H3H9
Cytogenetics Xq22.1
RefSeq Size 1123
RefSeq ORF 681
Synonyms my048; MY0876G05; WEX1
Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TCEAL2" proteins (4)
SKU Description Size Price
PH311139 TCEAL2 MS Standard C13 and N15-labeled recombinant protein (NP_525129) 10 ug
$3,360.00
LC409183 Lyophilized TCEAL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409183 Transient overexpression lysate of transcription elongation factor A (SII)-like 2 (TCEAL2) (as WB positive control) 100 ug
$436.00
TP710155 Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products