TCEAL2 (NM_080390) Human Mass Spec Standard

SKU
PH311139
TCEAL2 MS Standard C13 and N15-labeled recombinant protein (NP_525129)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211139]
Predicted MW 25.8 kDa
Protein Sequence
Protein Sequence
>RC211139 protein sequence
Red=Cloning site Green=Tags(s)

MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKA
KGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKR
KTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREF
RGGCRAPRRDTEDIPYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_525129
RefSeq Size 1123
RefSeq ORF 681
Synonyms my048; MY0876G05; WEX1
Locus ID 140597
UniProt ID Q9H3H9
Cytogenetics Xq22.1
Summary This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TCEAL2 (NM_080390) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409183 TCEAL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409183 Transient overexpression lysate of transcription elongation factor A (SII)-like 2 (TCEAL2) 100 ug
$436.00
TP311139 Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710155 Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.