OriGene Logo

NT5DC1 (NM_152729) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP311087
Recombinant protein of human 5'-nucleotidase domain containing 1 (NT5DC1), 20 µg
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501589 NT5DC1 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NT5DC1 or NM_152729"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211087 protein sequence
Red=Cloning site Green=Tags(s)

MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWDFCCKGLALDL
EDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCA
RVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPESVKKWLRQLKN
AGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLD
KPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE
SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP
LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689942
Locus ID 221294
UniProt ID Q5TFE4
Cytogenetics 6q22.1
RefSeq Size 3193
RefSeq ORF 1365
Synonyms C6orf200; LP2642; NT5C2L1
Summary While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family. provided by RefSeq, May 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "NT5DC1" proteins (3)
SKU Description Size Price
PH311087 NT5DC1 MS Standard C13 and N15-labeled recombinant protein (NP_689942) 10 ug
$3,360.00
LC403486 Lyophilized NT5DC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403486 Transient overexpression lysate of 5'-nucleotidase domain containing 1 (NT5DC1) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.