OriGene Logo

NT5DC1 (NM_152729) Human Mass Spec Standard

Be the first to review this product
SKU
PH311087
NT5DC1 MS Standard C13 and N15-labeled recombinant protein (NP_689942)
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501589 NT5DC1 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
100 ul
$447.00
LY403486 Transient overexpression lysate of 5'-nucleotidase domain containing 1 (NT5DC1) (as WB positive control)
100 ug
$436.00

Other products for "NT5DC1 or NM_152729"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211087
Predicted MW 51.8 kDa
Protein Sequence
Protein Sequence
>RC211087 protein sequence
Red=Cloning site Green=Tags(s)

MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWDFCCKGLALDL
EDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCA
RVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPESVKKWLRQLKN
AGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLD
KPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE
SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP
LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689942
RefSeq Size 3193
RefSeq ORF 1365
Synonyms C6orf200; LP2642; NT5C2L1
Locus ID 221294
UniProt ID Q5TFE4
Cytogenetics 6q22.1
Summary While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family. provided by RefSeq, May 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "NT5DC1" proteins (3)
SKU Description Size Price
LC403486 Lyophilized NT5DC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403486 Transient overexpression lysate of 5'-nucleotidase domain containing 1 (NT5DC1) (as WB positive control) 100 ug
$436.00
TP311087 Recombinant protein of human 5'-nucleotidase domain containing 1 (NT5DC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products