OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KRTCAP3 (NM_173853) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310983
Recombinant protein of human keratinocyte associated protein 3 (KRTCAP3), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "KRTCAP3 or NM_173853"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210983 protein sequence
Red=Cloning site Green=Tags(s)

MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTVANVISVGSGL
LSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLTVANGGRRLIADCHPGLLDPL
VPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAALSGYCCVAALTLRGVGPCRKDGLQGQLEEMT
ELESPKCKRQENEQLLDQNQEIRASQRSWV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_776252
Locus ID 200634
UniProt ID Q53RY4
Cytogenetics 2p23.3
RefSeq Size 906
RefSeq ORF 720
Synonyms KCP3
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KRTCAP3" proteins (5)
SKU Description Size Price
PH310983 KRTCAP3 MS Standard C13 and N15-labeled recombinant protein (NP_776252) 10 ug
$3,360.00
LC406322 Lyophilized KRTCAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432746 Lyophilized KRTCAP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406322 Transient overexpression lysate of keratinocyte associated protein 3 (KRTCAP3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432746 Transient overexpression lysate of keratinocyte associated protein 3 (KRTCAP3), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products