OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ETFB (NM_001985) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310894
Recombinant protein of human electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351170 Rabbit Polyclonal Anti-ETFB Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ETFB or NM_001985"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210894 protein sequence
Red=Cloning site Green=Tags(s)

MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQ
CQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAG
FLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIK
PGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001976
Locus ID 2109
UniProt ID P38117
Cytogenetics 19q13.41
RefSeq Size 933
RefSeq ORF 765
Synonyms FP585; MADD
Summary This gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ETFB" proteins (5)
SKU Description Size Price
PH310894 ETFB MS Standard C13 and N15-labeled recombinant protein (NP_001976) 10 ug
$3,360.00
LC419607 Lyophilized ETFB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423075 Lyophilized ETFB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419607 Transient overexpression lysate of electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423075 Transient overexpression lysate of electron-transfer-flavoprotein, beta polypeptide (ETFB), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products