OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMIM3 (NM_032947) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310700
Recombinant protein of human MSTP150 (MST150), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SMIM3 or NM_032947"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210700 protein sequence
Red=Cloning site Green=Tags(s)

MSTATRRVCGNVEGEPETPWSLPSLAGSFLPERSPQGTLEEELSWSCRGPGTGRSGGGPQQPRIPEPAAR
PGRSCALPPPGARRSRGTFQELPRAEVPGLGVASSCQIPCSPGDPEKHRAIPDPGTFRRLAAIWE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116565
Locus ID 85027
UniProt ID Q9BZL3
Cytogenetics 5q33.1
RefSeq Size 2344
RefSeq ORF 405
Synonyms C5orf62; MST150; NID67
Protein Categories Cytokines, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SMIM3" proteins (3)
SKU Description Size Price
PH310700 C5orf62 MS Standard C13 and N15-labeled recombinant protein (NP_116565) 10 ug
$3,360.00
LC409834 Lyophilized SMIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409834 Transient overexpression lysate of chromosome 5 open reading frame 62 (C5orf62) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products