OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPE65 (NM_000329) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310433
Recombinant protein of human retinal pigment epithelium-specific protein 65kDa (RPE65), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RPE65 or NM_000329"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210433 representing NM_000329
Red=Cloning site Green=Tags(s)

MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF
DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVG
EDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIP
PLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE
SNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW
EEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVV
VSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.8 kDa
Concentration >200 ug/mL as determined by Microplate Bradford Protein Assay method
Purity > 90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000320
Locus ID 6121
UniProt ID Q16518
Cytogenetics 1p31.3
RefSeq Size 2608
RefSeq ORF 1599
Synonyms BCO3; LCA2; mRPE65; p63; rd12; RP20; sRPE65
Summary The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital. provided by RefSeq, Oct 2017
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Families Druggable Genome
Protein Pathways Retinol metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPE65" proteins (4)
SKU Description Size Price
PH310433 RPE65 MS Standard C13 and N15-labeled recombinant protein (NP_000320) 10 ug
$3,360.00
LC400124 Lyophilized RPE65 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400124 Transient overexpression lysate of retinal pigment epithelium-specific protein 65kDa (RPE65) (as WB positive control) 100 ug
$436.00
TP762502 Purified recombinant protein of Human retinal pigment epithelium-specific protein 65kDa (RPE65), 340Tyr-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

Antigen-specificity of antiretinal antibodies in patients with noninfectious uveitis
Gibbs, Matsubara, Cao et al
Canadian Journal of Ophthalmology / Journal Canadien d'Ophtalmologie (2017)
Snippet: a trace of binding versus time. Pure recombinant human recoverin, S-antigen, IRBP, RPE65, TRYP1, and TRYP2 were commercially obtained (OriGene Technologies Inc;Rockville, Md.). Under conditions of continuous flow ... All 3 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products