RPE65 (NM_000329) Human Mass Spec Standard

SKU
PH310433
RPE65 MS Standard C13 and N15-labeled recombinant protein (NP_000320)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210433]
Predicted MW 61.4 kDa
Protein Sequence
Protein Sequence
>RC210433 representing NM_000329
Red=Cloning site Green=Tags(s)

MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF
DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVG
EDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIP
PLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE
SNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW
EEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVV
VSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000320
RefSeq Size 2608
RefSeq ORF 1599
Synonyms BCO3; LCA2; mRPE65; p63; rd12; RP20; sRPE65
Locus ID 6121
UniProt ID Q16518
Cytogenetics 1p31.3
Summary The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital. [provided by RefSeq, Oct 2017]
Protein Families Druggable Genome
Protein Pathways Retinol metabolism
Write Your Own Review
You're reviewing:RPE65 (NM_000329) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400124 RPE65 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400124 Transient overexpression lysate of retinal pigment epithelium-specific protein 65kDa (RPE65) 100 ug
$436.00
TP310433 Recombinant protein of human retinal pigment epithelium-specific protein 65kDa (RPE65), 20 µg 20 ug
$867.00
TP762502 Purified recombinant protein of Human retinal pigment epithelium-specific protein 65kDa (RPE65), 340Tyr-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.