OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPATA7 (NM_001040428) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310350
Recombinant protein of human spermatogenesis associated 7 (SPATA7), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349445 Rabbit Polyclonal Anti-SPATA7 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SPATA7 or NM_001040428"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210350 protein sequence
Red=Cloning site Green=Tags(s)

MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKL
TKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGP
EKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTP
RTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYD
AKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLG
LFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNEL
KNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDE
NHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSI
EDCPLDV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 64 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035518
Locus ID 55812
UniProt ID Q9P0W8
Cytogenetics 14q31.3
RefSeq Size 1935
RefSeq ORF 1701
Synonyms HEL-S-296; HSD-3.1; HSD3; LCA3
Summary This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2010
Protein Categories Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPATA7" proteins (5)
SKU Description Size Price
PH310350 SPATA7 MS Standard C13 and N15-labeled recombinant protein (NP_001035518) 10 ug
$3,360.00
LC413064 Lyophilized SPATA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421749 Lyophilized SPATA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413064 Transient overexpression lysate of spermatogenesis associated 7 (SPATA7), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY421749 Transient overexpression lysate of spermatogenesis associated 7 (SPATA7), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products