SPATA7 (NM_001040428) Human Mass Spec Standard

SKU
PH310350
SPATA7 MS Standard C13 and N15-labeled recombinant protein (NP_001035518)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210350]
Predicted MW 64.2 kDa
Protein Sequence
Protein Sequence
>RC210350 protein sequence
Red=Cloning site Green=Tags(s)

MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKL
TKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGP
EKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTP
RTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYD
AKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLG
LFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNEL
KNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDE
NHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSI
EDCPLDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035518
RefSeq Size 1935
RefSeq ORF 1701
Synonyms HEL-S-296; HSD-3.1; HSD3; LCA3
Locus ID 55812
UniProt ID Q9P0W8
Cytogenetics 14q31.3
Summary This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:SPATA7 (NM_001040428) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413064 SPATA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421749 SPATA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413064 Transient overexpression lysate of spermatogenesis associated 7 (SPATA7), transcript variant 1 100 ug
$665.00
LY421749 Transient overexpression lysate of spermatogenesis associated 7 (SPATA7), transcript variant 2 100 ug
$436.00
TP310350 Recombinant protein of human spermatogenesis associated 7 (SPATA7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.