OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TYW3 (NM_138467) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310021
Recombinant protein of human tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA320095 Rabbit Polyclonal TYW3 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TYW3 or NM_138467"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210021 protein sequence
Red=Cloning site Green=Tags(s)

MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC
CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT
MLVVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE
KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612476
Locus ID 127253
UniProt ID Q6IPR3
Cytogenetics 1p31.1
RefSeq Size 3448
RefSeq ORF 777
Synonyms C1orf171
Summary Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).supplied by OMIM, Mar 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TYW3" proteins (5)
SKU Description Size Price
PH310021 TYW3 MS Standard C13 and N15-labeled recombinant protein (NP_612476) 10 ug
$3,360.00
LC408593 Lyophilized TYW3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431186 Lyophilized TYW3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408593 Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431186 Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products