SPIN2A (NM_019003) Human Recombinant Protein

CAT#: TP309934

Recombinant protein of human spindlin family, member 2A (SPIN2A), 20 µg

Product Images

Coomassie blue staining of purified SPIN2A protein (Cat# TP309934). The protein was produced from HEK293T cells transfected with SPIN2A cDNA clone (Cat# RC209934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209934 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPCRNIVGCRISHGWKEGDEPITQWKG
  TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE
  HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI
  GKHVEYTKEDGSKRIGMVIHQVETKPSVYFIKFDDDFHIYVYDLVKKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061876
• Locus ID: 54466
• UniProt ID: Q99865, A0A024R9W1
• Cytogenetics: Xp11.21
• Refseq Size: 1351
• Refseq ORF: 774
• Synonyms: dJ323P24.1; DXF34; SPIN2; TDRD25
• Summary: This gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. [provided by RefSeq, Nov 2009]