OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF706 (NM_016096) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309807
Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA331929 Rabbit Polyclonal Anti-ZNF706 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ZNF706 or NM_016096"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209807 protein sequence
Red=Cloning site Green=Tags(s)

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE
LADVQA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057180
Locus ID 51123
UniProt ID Q9Y5V0
Cytogenetics 8q22.3
RefSeq Size 2755
RefSeq ORF 228
Synonyms HSPC038; PNAS-106; PNAS-113
Summary Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF706" proteins (11)
SKU Description Size Price
PH309807 ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180) 10 ug
$3,360.00
PH316962 ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) 10 ug
$3,360.00
PH320360 ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035976) 10 ug
$3,360.00
LC414186 Lyophilized ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420950 Lyophilized ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420951 Lyophilized ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414186 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420950 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420951 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP316962 Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 1, 20 µg 20 ug
$867.00
TP320360 Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products