ZNF706 (NM_016096) Human Mass Spec Standard

SKU
PH309807
ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209807]
Predicted MW 8.5 kDa
Protein Sequence
Protein Sequence
>RC209807 protein sequence
Red=Cloning site Green=Tags(s)

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE
LADVQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057180
RefSeq Size 2755
RefSeq ORF 228
Synonyms HSPC038; PNAS-106; PNAS-113
Locus ID 51123
UniProt ID Q9Y5V0
Cytogenetics 8q22.3
Summary Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZNF706 (NM_016096) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316962 ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) 10 ug
$3,255.00
PH320360 ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035976) 10 ug
$3,255.00
LC414186 ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420950 ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420951 ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414186 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 2 100 ug
$436.00
LY420950 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 100 ug
$436.00
LY420951 Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 100 ug
$436.00
TP309807 Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316962 Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320360 Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.