OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EEF1A1 (NM_001402) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309697
Recombinant protein of human eukaryotic translation elongation factor 1 alpha 1 (EEF1A1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA375720 eEF1A1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EEF1A1 or NM_001402"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209697 protein sequence
Red=Cloning site Green=Tags(s)

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW
FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF
APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP
GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity ELISA capture for autoantibodies (PMID: 26616590)
Biolayer interferometry (BLI) assay (PMID: 26624286)
Binding assay (PMID: 29588400)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001393
Locus ID 1915
UniProt ID P68104
Cytogenetics 6q13
RefSeq Size 3528
RefSeq ORF 1386
Synonyms CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; LENG7; PTI1
Summary This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EEF1A1" proteins (3)
SKU Description Size Price
PH309697 EEF1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001393) 10 ug
$3,360.00
LC419954 Lyophilized EEF1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419954 Transient overexpression lysate of eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Fluorogenic RNA-based biomaterials for imaging and tracking the cargo of extracellular vesicles
Bonacquisti, Ferguson, Wadsworth et al
J Control Release (2024) 374, 349-368 DOI: 10.1016/j.jconrel.2024.07.043
Cited by 10
AI Summary: OriGene provided purified protein used in the study, which was essential for the development and validation of the EXO-Probe RNA-based biomaterial for imaging and tracking extracellular vesicle RNAs.
Snippet: Purified protein was obtained from Origene and exchanged into a buffer containing 150 mM KCl and 25 mM tris-HCl, pH 7.5, using 30 kDa Zeba spin desalting columns (
HIV-1 Uncoating and Reverse Transcription Require eEF1A Binding to Surface-Exposed Acidic Residues of the Reverse Transcriptase Thumb Domain
Rawle, Li, Swedberg et al
MBio (2018) 9 (2) DOI: 10.1128/mBio.00316-18
AI Summary: In this study, the OriGene recombinant eEF1A1 protein was used in binding assays to investigate its interaction with HIV-1 reverse transcriptase, helping to demonstrate the importance of specific RT thumb domain residues in viral uncoating and reverse transcription.
Snippet: …Purified recombinant eEF1A1 (OriGene) was biotinylated with EZ-Link-sulfo-NHS-biotin in accordance with the manufacturer’s instructions (Pierce Biotechnology, IL, USA) and immobilized on Octet Red system streptavidin-coated bio;... -0.5 Centrifugal Filter Unit with Ultracel-100 membrane (Amicon). …Purified recombinant eEF1A1 (OriGene) was biotinylated with EZ-Link-sulfo-NHS-biotin in accordance with the manufacturer’s instructions (Pierce Biotechnology, IL, USA) and immobilized on Octet Red system streptavidin-coated bio
FigureFigureFigure
Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
Li, Wei, Rawle et al
PLoS Pathog. (2015) 11 (12), e1005289 DOI: 10.1371/journal.ppat.1005289
Cited by 22
AI Summary: OriGene products, specifically full-length human eEF1A1, eEF1B2, eEF1G, and eEF1D proteins with C-terminal MYC/DDK tags, were used to study and characterize the interaction between eEF1A and HIV-1 reverse transcriptase in this research.
Snippet: Full-length human proteins expressed in HEK293 cells including eEF1A1, 1B2, 1G and 1D proteins having C-terminal MYC/DDK tags were purchased from OriGene (OriGene Technologies, MD, USA) and recombinant 6×His-tagged HIV-1 RT p51, RT p66, IN and Gag ... Cite SaveSaving
FigureFigureFigure
The Level of Autoantibodies Targeting Eukaryote Translation Elongation Factor 1 α1 and Ubiquitin-Conjugating Enzyme 2L3 in Nondiabetic Young Adults
Kim, Kwak, Hwang et al
Diabetes Metab J (2015)
AI Summary: OriGene's EEF1A1 and UBE2L3 proteins were used to coat ELISA plates, enabling the measurement of autoantibody levels against these targets in the study participants.
Snippet: Enzyme-linked immunosorbent assay. Immunosorbent 96-well plates coated with EEF1A1 or UBE2L3 (Origene Rockville, MD, USA) were incubated with diluted serum samples (1:1,000 to 1:2,500) in phosphate-buffered saline buffer. ... Cite SaveSaving
Identification of Novel Autoantibodies in Type 1 Diabetic Patients Using a High-Density Protein Microarray
Koo, Chae, Kim et al
Diabetes (2014)
Cited by 43
AI Summary: OriGene's recombinant EEF1A1 and UBE2L3 proteins were used to coat ELISA plates, enabling the detection and validation of novel autoantibodies in type 1 diabetic patients in this study.
Snippet: recombinant proteins. Plates coated with EEF1A1 or UBE2L3 (Origene) were incubated with diluted serum samples (1:1,000–1:10,000) in PBS. All experiments were performed in triplicate for each patient and control sample. The ... Cite SaveSaving
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products