CNPY2 (NM_014255) Human Recombinant Protein

SKU TP309441

Recombinant protein of human canopy 2 homolog (zebrafish) (CNPY2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209441 protein sequence; Red=Cloning site Green=Tags(s); ; MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP; YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSDISGTLKFACESI; VEEYEDELIEFFSREADNVKDKLCSKRTDLCDHALHISHDEL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_055070
• Locus ID: 10330
• UniProt ID: Q9Y2B0
• Cytogenetics: 12q13.3
• RefSeq Size: 1247
• RefSeq ORF: 546
• Synonyms: HP10390; MSAP; TMEM4; ZSIG9
• Summary: Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.[UniProtKB/Swiss-Prot Function]