GNG2 (NM_053064) Human Recombinant Protein

CAT#: TP309299

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 2 (GNG2), 20 µg

Product Images

Coomassie blue staining of purified GNG2 protein (Cat# TP309299). The protein was produced from HEK293T cells transfected with GNG2 cDNA clone (Cat# RC209299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
  L
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444292
• Locus ID: 54331
• UniProt ID: P59768
• Cytogenetics: 14q22.1
• Refseq Size: 3903
• Refseq ORF: 213
• Summary: This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway