GAPT (NM_152687) Human Recombinant Protein
CAT#: TP309003
Recombinant protein of human GRB2-binding adaptor protein, transmembrane (GAPT), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209003 protein sequence
Red=Cloning site Green=Tags(s) MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLR HEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPR PSEVPQDEDIYILPDSY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689900 |
Locus ID | 202309 |
UniProt ID | Q8N292, A0A024QZS2 |
Cytogenetics | 5q11.2 |
Refseq Size | 2216 |
Refseq ORF | 471 |
Synonyms | C5orf29 |
Summary | Negatively regulates B-cell proliferation following stimulation through the B-cell receptor. May play an important role in maintenance of marginal zone (MZ) B-cells (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407363 | GAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407363 | Transient overexpression lysate of GRB2-binding adaptor protein, transmembrane (GAPT) |
USD 436.00 |
|
PH309003 | GAPT MS Standard C13 and N15-labeled recombinant protein (NP_689900) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review