RDH10 (NM_172037) Human Recombinant Protein

CAT#: TP308980

Recombinant protein of human retinol dehydrogenase 10 (all-trans) (RDH10), 20 µg

Product Images

Coomassie blue staining of purified RDH10 protein (Cat# TP308980). The protein was produced from HEK293T cells transfected with RDH10 cDNA clone (Cat# RC208980) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208980 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT
  QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS
  VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY
  CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI
  LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_742034
• Locus ID: 157506
• UniProt ID: Q8IZV5, A0A024R7X6
• Cytogenetics: 8q21.11
• Refseq Size: 3981
• Refseq ORF: 1023
• Synonyms: SDR16C4
• Summary: This gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for limb, craniofacial, and organ development. [provided by RefSeq, Dec 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Metabolic pathways, Retinol metabolism