CUEDC1 (NM_017949) Human Recombinant Protein

CAT#: TP308926

Recombinant protein of human CUE domain containing 1 (CUEDC1), 20 µg

Product Images

Coomassie blue staining of purified CUEDC1 protein (Cat# TP308926). The protein was produced from HEK293T cells transfected with CUEDC1 cDNA clone (Cat# RC208926) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208926 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPNMDYDIIECVL
  RANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEPDSSDEEPPPVYSPPAYHMHV
  FDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGNLPDDFLRILPQQLDSIQGNAGGPKPGSGEG
  CPPAMAGPGPGDQESRWKQYLEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGN
  DFGFSSPVPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAA
  STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 42.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060419
• Locus ID: 404093
• UniProt ID: Q9NWM3
• Cytogenetics: 17q22
• Refseq Size: 3638
• Refseq ORF: 1158
• Synonyms: DKFZp547L163; FLJ20739
• Protein Families: Druggable Genome