OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AGR3 (NM_176813) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308897
Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA321945 Anti-AGR3 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "AGR3 or NM_176813"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208897 protein sequence
Red=Cloning site Green=Tags(s)

MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED
CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL
YTYEPRDLPLLIENMKKALRLIQSEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_789783
Locus ID 155465
UniProt ID Q8TD06
Cytogenetics 7p21.1
RefSeq Size 763
RefSeq ORF 498
Synonyms AG-3; AG3; BCMP11; hAG-3; HAG3; PDIA18
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This gene is expressed in ciliated airway epithelial cells and, in mouse, plays a role in ciliary beat frequency in multiciliated cells. This gene is also over-expressed in breast, ovarian, and prostrate cancers. provided by RefSeq, Dec 2016
Protein Categories Intracellular Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AGR3" proteins (4)
SKU Description Size Price
PH308897 AGR3 MS Standard C13 and N15-labeled recombinant protein (NP_789783) 10 ug
$3,360.00
LC403593 Lyophilized AGR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403593 Transient overexpression lysate of anterior gradient homolog 3 (Xenopus laevis) (AGR3) (as WB positive control) 100 ug
$436.00
TP720456 Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products