OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AGR3 (NM_176813) Human Mass Spec Standard

Be the first to review this product
SKU
PH308897
AGR3 MS Standard C13 and N15-labeled recombinant protein (NP_789783)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321945 Anti-AGR3 Rabbit Polyclonal Antibody
100 ul
$305.00
LY403593 Transient overexpression lysate of anterior gradient homolog 3 (Xenopus laevis) (AGR3) (as WB positive control) 100 ug
$436.00

Other products for "AGR3 or NM_176813"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208897
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC208897 protein sequence
Red=Cloning site Green=Tags(s)

MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLED
CQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRL
YTYEPRDLPLLIENMKKALRLIQSEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789783
RefSeq Size 763
RefSeq ORF 498
Synonyms AG-3; AG3; BCMP11; hAG-3; HAG3; PDIA18
Locus ID 155465
UniProt ID Q8TD06
Cytogenetics 7p21.1
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This gene is expressed in ciliated airway epithelial cells and, in mouse, plays a role in ciliary beat frequency in multiciliated cells. This gene is also over-expressed in breast, ovarian, and prostrate cancers. provided by RefSeq, Dec 2016
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AGR3" proteins (4)
SKU Description Size Price
LC403593 Lyophilized AGR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403593 Transient overexpression lysate of anterior gradient homolog 3 (Xenopus laevis) (AGR3) (as WB positive control) 100 ug
$436.00
TP308897 Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3), 20 µg 20 ug
$867.00
TP720456 Recombinant protein of human anterior gradient homolog 3 (Xenopus laevis) (AGR3) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products