OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDX1 (NM_004939) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308769M
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (DDX1), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,508.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375381 DDX1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DDX1 or NM_004939"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208769 protein sequence
Red=Cloning site Green=Tags(s)

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD
QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCH
DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK
DLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT
KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRL
DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIK
ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER
FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV
CSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS
YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 82.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Biolayer interferometry (BLI) assay (PMID: 25496916)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004930
Locus ID 1653
UniProt ID Q92499
Cytogenetics 2p24.3
RefSeq Size 2755
RefSeq ORF 2220
Synonyms DBP-RB; UKVH5d
Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. provided by RefSeq, Jul 2008
Protein Categories Cytokines, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Chemical profiling of DNA G-quadruplex-interacting proteins in live cells
Zhang, Spiegel, Martínez Cuesta et al
Nat Chem (2021) 13 (7), 626-633 DOI: 10.1038/s41557-021-00736-9
Cited by 165
AI Summary: OriGene products, specifically RBM22 (TP760056) and Myc/DDK-tagged DDX1 (TP308769), were used as recombinant proteins in ELISA assays to study and validate the interactions between candidate proteins and DNA G-quadruplex structures in this research.
Snippet: H00029128-P01) and DDX24 (Abnova, catalogue no. H00057062-P01), HIS-tagged SMARCA4 (Abcam, catalogue no. ab82237), RBM22 (OriGene, TP760056) and Myc/DDK-tagged DDX1 (OriGene, TP308769) in ELISA buffer (100 mM KCl and 50 mM KH 2 PO 4
FigureFigureFigure
A HIV-1 Tat mutant protein disrupts HIV-1 Rev function by targeting the DEAD-box RNA helicase DDX1
Lin, Sivakumaran, Jones et al
Retrovirology (2014) 11 (1), 121 DOI: 10.1186/PREACCEPT-7500780551442434
AI Summary: OriGene’s recombinant DDX1 and DDX3 proteins were used in this study to investigate and confirm the direct interaction between the HIV-1 Tat mutant Nullbasic and the cellular helicase DDX1, elucidating how Nullbasic disrupts HIV-1 Rev function.
Snippet: Recombinant proteins Recombinant DDX1 and DDX3 proteins were purchased from OriGene. The recombinant Nullbasic- FLAG-V5-6xHis was produced in E. coli strain BL21-AI (Invitrogen) transformed by pDEST42-Nullbasic-FLAG. A 200 ml culture was grown in Luria broth to log phase and induced with 0.2% arabinose and 1 mM IPTG
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products