OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ribonuclease T2 (RNASET2) (NM_003730) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308746L
Recombinant protein of human ribonuclease T2 (RNASET2), 1 mg
Size:
1 mg 20 ug 100 ug
  $7,820.00
6 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350352 Rabbit Polyclonal Anti-RNASET2 Antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ribonuclease T2 or NM_003730"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208746 protein sequence
Red=Cloning site Green=Tags(s)

MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD
KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE
LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL
QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003721
Locus ID 8635
UniProt ID O00584
Cytogenetics 6q27
RefSeq Size 1250
RefSeq ORF 768
Synonyms bA514O12.3; RNASE6PL
Summary This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Rnaset2 inhibits melanocyte outgrowth possibly through interacting with shootin1
Wang, Wang, Le et al
J Dermatol Sci (2015) 80 (1), 25-32 DOI: 10.1016/j.jdermsci.2015.07.004
Cited by 8
AI Summary: In this study, OriGene’s human recombinant Rnaset2 protein was used to treat melanocytes and other cell types, enabling the researchers to demonstrate that Rnaset2 inhibits melanocyte outgrowth and alters the actin network, thereby contributing to the investigation of its role in vitiligo pathogenesis.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products