Ribonuclease T2 (RNASET2) (NM_003730) Human Recombinant Protein

SKU TP308746

Recombinant protein of human ribonuclease T2 (RNASET2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208746 protein sequence; Red=Cloning site Green=Tags(s); ; MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD; KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE; LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL; QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003721
• Locus ID: 8635
• UniProt ID: O00584
• Cytogenetics: 6q27
• RefSeq Size: 1250
• RefSeq ORF: 768
• Synonyms: bA514O12.3; RNASE6PL
• Summary: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein