OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SRC (NM_005417) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308622M
Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,508.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SRC or NM_005417"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208622 representing NM_005417
Red=Cloning site Green=Tags(s)

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS
DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV
APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL
DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC
FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL
DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC
PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005408
Locus ID 6714
UniProt ID P12931
Cytogenetics 20q11.23
RefSeq Size 4145
RefSeq ORF 1608
Synonyms ASV; c-SRC; p60-Src; SRC1; THC6
Summary This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Cardiovascular diseases, Cytokines, Enzyme: Kinases, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Stem cell relevant signaling - JAK/STAT signaling pathway
Protein Pathways Adherens junction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, GnRH signaling pathway, Tight junction, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Glycogen Synthase Kinase 3β Regulates Antiviral Responses of TLR3 via TRAF2-Src Axis
Ko, Park, Lee et al
J Immunol (2019) 203 (11), 2990-2999 DOI: 10.4049/jimmunol.1900685
Cited by 11
AI Summary: In this paper, OriGene products—including the GSK3β shRNA (TL506527), GSK3β expression plasmid (RC210307), and TRAF2 expression plasmid (RC201122)—were used to manipulate gene expression and investigate the roles of GSK3β and TRAF2 in regulating Src phosphorylation and TLR3-mediated antiviral responses.
Two novel ligand-independent variants of the VEGFR-1 receptor are expressed in human testis and spermatozoa, one of them with the ability to activate SRC proto-oncogene tyrosine kinases
Alvarez-Palomo, Barrot-Feixat, Sarret et al
Oncotarget (2019) 10 (56), 5871-5887 DOI: 10.18632/oncotarget.27232
Snippet: :"JF509745","term_id":"379023470","term_text":"JF509745"}}JF509745 [/nuccore/JF509745]. RECOMBINANT CLONES, CLONING, ELECTRO-TRANSFORMATION, AND DNA PREPARATION Human Src recombinant clone was from OriGene Technologies and contained v-Src sarcoma transcript variant 1 ({"type":"entrez-nucleotide","attrs":{"text":"NM_005417","term_id":"520262038","term_text":"NM_005417"}}NM_005417 [/nuccore/NM_005
FigureFigureFigure
JNK mediates mouse liver injury through a novel Sab (SH3BP5) dependent pathway leading to inactivation of intramitochondrial Src
Win, Than, Min et al
Hepatology (2016)
Cited by 188
AI Summary: OriGene’s recombinant Src and DOK4 proteins were used in in-vitro phosphatase assays to investigate the molecular mechanisms by which JNK-Sab signaling leads to mitochondrial Src inactivation and liver injury.
Snippet: The in-vitro phosphatase reaction system 25 was modified. 1μg of Src recombinant protein (Origene) was ... Src by auto-phosphorylation. 1μg of DOK4 recombinant protein (Origene) was added into the reactions as indicated, and incubated for 30 min. ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products