OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Serum Response Factor (SRF) (NM_003131) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308596M
Recombinant protein of human serum response factor (c-fos serum response element-binding transcription factor) (SRF), 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA381996 SRF Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Serum Response Factor or NM_003131"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208596 representing NM_003131
Red=Cloning site Green=Tags(s)

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAP
TAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKT
RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSET
GKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ
TAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSN
LTELQVVNLDTAHSTKSE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003122
Locus ID 6722
UniProt ID P11831
Cytogenetics 6p21.1
RefSeq Size 4343
RefSeq ORF 1524
Synonyms MCM1
Summary This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2014
Protein Categories Cytokines, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Haploinsufficiency in PTPN2 leads to early-onset systemic autoimmunity from Evans syndrome to lupus
Jeanpierre, Cognard, Tusseau et al
J Exp Med (2024) 221 (9) DOI: 10.1084/jem.20232337
Cited by 32
AI Summary: OriGene’s PTPN2 full sequence plasmid (isoform TC48, NM_002828) was used in this study to investigate the functional consequences of PTPN2 mutations associated with early-onset systemic autoimmunity.
Snippet: Plasmid containing PTPN2 full sequence (isoform TC48, NM_002828) was obtained from OriGene and subcloned in lentiviral vector p197 pRRLSIN-MND-IRES2-ZsGreen
FigureFigureFigure
Functional dissection of human cardiac enhancers and noncoding de novo variants in congenital heart disease
Xiao, Zhang, Morton et al
Nat Genet (2024)
Cited by 55
AI Summary: OriGene products contributed to this study by providing expression plasmids for the human proteins SRF (TP308596), TBX20 (TP762422), HIC2 (TP760963), SOX9 (TP308944), and GATA4 (TP310945), which were used to investigate the effects of noncoding variants on cardiac gene regulation.
Snippet: human proteins used in this study included SMAD2 (Abcam, ab85329), SRF (OriGene, TP308596), TBX20 (OriGene, TP762422), HIC2 (OriGene, TP760963), SOX9 (OriGene, TP308944) and GATA4 (OriGene, TP310945). The percentage of probe shifted was calculated by quantifying the free and shifted probe intensities using Fiji and then calculating
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products