MTHFR (NM_005957) Human Recombinant Protein

CAT#: TP308588

Recombinant protein of human 5,10-methylenetetrahydrofolate reductase (NADPH) (MTHFR)

Product images

Coomassie blue staining of purified MTHFR protein (Cat# TP308588). The protein was produced from HEK293T cells transfected with MTHFR cDNA clone (Cat# RC208588) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208588 representing NM_005957
  Red=Cloning site Green=Tags(s)
  
  MVNEARGNSSLNPCLEGSASSGSESSKDSSRCSTPGLDPERHERLREKMRRRLESGDKWFSLEFFPPRTA
  EGAVNLISRFDRMAAGGPLYIDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTCCRQRLEEITG
  HLHKAKQLGLKNIMALRGDPIGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKGHPEAGSFEAD
  LKHLKEKVSAGADFIITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVKLSKLEVPQEI
  KDVIEPIKDNDAAIRNYGIELAVSLCQELLASGLVPGLHFYTLNREMATTEVLKRLGMWTEDPRRPLPWA
  LSAHPKRREEDVRPIFWASRPKSYIYRTQEWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPKEELLKM
  WGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWNDEPLAAETSLLKEELLRVNRQGILTINSQPNING
  KPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVT
  WGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDFPLDN
  CLWQVVEDTLELLNRPTQNARETEAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 74.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005948
• Locus ID: 4524
• UniProt ID: P42898, Q8IU67, Q59GJ6
• Cytogenetics: 1p36.22
• Refseq Size: 6099
• Refseq ORF: 1968
• Synonyms: 5,10-methylenetetrahydrofolate reductase (NADPH); methylenetetrahydrofolate reductase intermediate form; OTTHUMP00000002367; OTTHUMP00000002368
• Summary: The protein encoded by this gene catalyzes the conversion of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate, a co-substrate for homocysteine remethylation to methionine. Genetic variation in this gene influences susceptibility to occlusive vascular disease, neural tube defects, colon cancer and acute leukemia, and mutations in this gene are associated with methylenetetrahydrofolate reductase deficiency.[provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Methane metabolism, One carbon pool by folate