CCDC103 (NM_213607) Human Recombinant Protein

CAT#: TP308345

Recombinant protein of human coiled-coil domain containing 103 (CCDC103), 20 µg

Product Images

Coomassie blue staining of purified CCDC103 protein (Cat# TP308345). The protein was produced from HEK293T cells transfected with CCDC103 cDNA clone (Cat# RC208345) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208345 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT
  VPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVG
  FGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKEG
  LSWEEQGLEEQSGGLQEEERLLQELLELYQVD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_998772
• Locus ID: 388389
• UniProt ID: Q8IW40
• Cytogenetics: 17q21.31
• Refseq Size: 1766
• Refseq ORF: 726
• Synonyms: CILD17; PR46b; SMH
• Summary: This gene encodes a protein that contains a coiled-coil domain. [provided by RefSeq, Apr 2012]